#Head information
NAME            6ba1
TYPE            beta-alpha
REPRESENTATIVE  1ldm_296
MEMBERS         5
CLUSTER         2

#Loop element
>  1ldm_296    gisniVKMKLKpneeqqlqksattlwdiqk....  6ba1_0.pdb 	0
>9ldt-A_298    gisdvVKVTLTpeeeahlkksadtlwgiqkel..  6ba1_1.pdb 	0
>1lth-R_280    gvnntINTPVSdkelaalkrsaetlketaa....  6ba1_2.pdb 	1
>1ldn-G_283    girevIEIELNddeknrfhhsaatlksvlar...  6ba1_3.pdb 	0
>1hyh-A_262    gvlaeTTLDLTtdeqekllqsrdyiqqrfdeiv.  6ba1_4.pdb 	1

#Motif sequence
GISNIVKMKLKPNEEQQLQKSATTLWDIQK....
GISDVVKVTLTPEEEAHLKKSADTLWGIQKEL..
GVNNTINTPVSDKELAALKRSAETLKETAA....
GIREVIEIELNDDEKNRFHHSAATLKSVLAR...
GVLAETTLDLTTDEQEKLLQSRDYIQQRFDEIV.

#Loop sequence
VKMKLK
VKVTLT
INTPVS
IEIELN
TTLDLT

#Fingerprint
I K I D L T 
: : L E : : 
V E M K : K 
: N T P : N 
T T V T V S 

#Geometry parameters
DISTANCE                16.61 ( 0.24)
Vector1                 (    0.95   -0.18   -0.25)
Vector2                 (   -0.51    0.54    0.67)
Vector3                 (    0.80    0.38   -0.47)
Struc diversity(A)      (  1.3  2.1  2.1  2.5  1.9  1.3)

#RMSD matrix of conformation of loops (A)
 0.00 0.60 1.60 0.90 1.56
 0.60 0.00 1.07 0.79 1.21
 1.60 1.07 0.00 1.38 1.01
 0.90 0.79 1.38 0.00 1.38
 1.56 1.21 1.01 1.38 0.00

#Sequence identities difference matrix of loop (%)
  0.0 50.0100.0 83.0 83.0
 50.0  0.0100.0 83.0 67.0
100.0100.0  0.0 83.0100.0
 83.0 83.0 83.0  0.0 83.0
 83.0 67.0100.0 83.0  0.0

#Sequence identities difference matrix of motif (%)
  0.0 38.0 65.0 68.0 82.0
 38.0  0.0 68.0 68.0 74.0
 65.0 68.0  0.0 62.0 82.0
 68.0 68.0 62.0  0.0 82.0
 82.0 74.0 82.0 82.0  0.0

#Sequence identities difference matrix of global PDB chains (%)
  0.0 23.0 62.0 66.0 76.0
 23.0  0.0 62.0 64.0 73.0
 62.0 62.0  0.0 60.0 74.0
 66.0 64.0 60.0  0.0 70.0
 76.0 73.0 74.0 70.0  0.0

#FASTA SCORE matrix of loop sequence
    -   15    3   13    5
    -    -    6   13    9
    -    -    -    5    -
    -    -    -    -    7
    -    -    -    -    -

#FASTA SCORE matrix of motif sequence
    -  125   47   58   19
    -    -   54   56   32
    -    -    -   51   13
    -    -    -    -   28
    -    -    -    -    -

#FASTA SCORE matrix of global PDB chain sequence
    - 1687  796  677  351
    -    -  827  730  401
    -    -    -  763  404
    -    -    -    -  520
    -    -    -    -    -